PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C011064P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ZF-HD
Protein Properties Length: 239aa    MW: 26333.3 Da    PI: 7.0777
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C011064P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.22e-3347102359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++rY+eClkNhA+ +GghavDGCgEfmp+ geeg+++alkCaAC+CHRnFHR+e+++
  MELO3C011064P1  47 SIRYRECLKNHAIGIGGHAVDGCGEFMPA-GEEGSIDALKCAACNCHRNFHRKETDS 102
                     789*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-2435102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.5E-3048100IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-304999IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.7355099IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.58E-20160236IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-31163237IPR009057Homeodomain-like
TIGRFAMsTIGR015659.3E-27175231IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MEFDEENDEE IMDEMPIATH HCDSLTNSAS TRPKPGEGAS TARKTSSIRY RECLKNHAIG  60
IGGHAVDGCG EFMPAGEEGS IDALKCAACN CHRNFHRKET DSDQGHYYYQ QQQQICPYRG  120
PTPHPSAYVY MRGAPVQQRA LALPAAAGGR EEDDTSNPSS SGGGGGGSGS GLLLKKRFRT  180
KFSSEQKEKM LEFAEKVGWT IQKHDEADVE RFCMETGVRR QVLKVWMHNN KHTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-271762331875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818230.0LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014.
GenBankLN7132570.0LN713257.1 Cucumis melo genomic chromosome, chr_3.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008444884.10.0PREDICTED: zinc-finger homeodomain protein 2
SwissprotQ9SB614e-74ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A0A0LRT71e-148A0A0A0LRT7_CUCSA; Uncharacterized protein
STRINGVIT_18s0001g07140.t017e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-68homeobox protein 22